Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAMP-activated protein kinase, alpha-1 subunit
LigandBDBM50242401
Substrate/Competitorn/a
Meas. Tech.ChEMBL_529575
EC50 116±n/a nM
Citation Göransson, OMcBride, AHawley, SARoss, FAShpiro, NForetz, MViollet, BHardie, DGSakamoto, K Mechanism of action of A-769662, a valuable tool for activation of AMP-activated protein kinase. J Biol Chem282:32549-60 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AMP-activated protein kinase, alpha-1 subunit
Name:5'-AMP-activated protein kinase catalytic subunit alpha-1/beta-1/gamma-1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:63987.64
Organism:Rattus norvegicus
Description:ChEMBL_529575
Residue:559
Sequence:
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSISNYRSCQRSDSDAEAQGKPSEVSLTSSVTSLDSSPVDVAPRPG
SHTIEFFEMCANLIKILAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50242401
NameBDBM50242401
Synonyms:4-hydroxy-3-(2'-hydroxybiphenyl-4-yl)-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile | A-769662 | CHEMBL512504
TypeSmall organic molecule
Emp. Form.C20H12N2O3S
Mol. Mass.360.386
SMILESOc1ccccc1-c1ccc(cc1)-c1csc2[nH]c(=O)c(C#N)c(O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a