Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Chk1
LigandBDBM50243262
Substrate/Competitorn/a
Meas. Tech.ChEMBL_491561
IC50 800±n/a nM
Citation Janetka, JWAlmeida, LAshwell, SBrassil, PJDaly, KDeng, CGero, TGlynn, REHorn, CLIoannidis, SLyne, PNewcombe, NJOza, VBPass, MSpringer, SKSu, MToader, DVasbinder, MMYu, DYu, YZabludoff, SD Discovery of a novel class of 2-ureido thiophene carboxamide checkpoint kinase inhibitors. Bioorg Med Chem Lett18:4242-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Chk1
Name:Serine/threonine-protein kinase Chk1
Synonyms:CHK1 checkpoint homolog | Checkpoint kinase-1 (CHK1)
Type:Enzyme Catalytic Domain
Mol. Mass.:54443.02
Organism:Homo sapiens (Human)
Description:gi_166295192
Residue:476
Sequence:
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50243262
NameBDBM50243262
Synonyms:5-METHYL[1,2,4]TRIAZOLO[4,3-A]QUINOLIN-1(2H)-ONE | 5-methyl-[1,2,4]triazolo[4,3-a]quinolin-1(2H)-one | CHEMBL487274
TypeSmall organic molecule
Emp. Form.C11H9N3O
Mol. Mass.199.2087
SMILESCc1cc2n[nH]c(=O)n2c2ccccc12
Structure
n/a