Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM50273218
Substrate/Competitorn/a
Meas. Tech.ChEMBL_509760
IC50>3000±n/a nM
Citation Irie, OYokokawa, FEhara, TIwasaki, AIwaki, YHitomi, YKonishi, KKishida, MToyao, AMasuya, KGunji, HSakaki, JIwasaki, GHirao, HKanazawa, TTanabe, KKosaka, THart, TWHallett, A 4-Amino-2-cyanopyrimidines: novel scaffold for nonpeptidic cathepsin S inhibitors. Bioorg Med Chem Lett18:4642-6 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X
Type:Enzyme
Mol. Mass.:36975.68
Organism:Homo sapiens (Human)
Description:P43235
Residue:329
Sequence:
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50273218
NameBDBM50273218
Synonyms:2-Cyano-4-[(spiro[2.5]oct-6-ylmethyl)-amino]-pyrimidine-5-carboxylic acid phenethyl-amide | CHEMBL515663
TypeSmall organic molecule
Emp. Form.C23H27N5O
Mol. Mass.389.4934
SMILESO=C(NCCc1ccccc1)c1cnc(nc1NCC1CCC2(CC2)CC1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a