Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase 11
LigandBDBM4567
Substrate/Competitorn/a
Meas. Tech.ChEMBL_540163
IC50>10000±n/a nM
Citation Hur, WVelentza, AKim, SFlatauer, LJiang, XValente, DMason, DESuzuki, MLarson, BZhang, JZagorska, ADidonato, MNagle, AWarmuth, MBalk, SPPeters, ECGray, NS Clinical stage EGFR inhibitors irreversibly alkylate Bmx kinase. Bioorg Med Chem Lett18:5916-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase 11
Name:Serine/threonine-protein kinase 11
Synonyms:LKB1
Type:PROTEIN
Mol. Mass.:48640.33
Organism:Homo sapiens (Human)
Description:ChEMBL_655439
Residue:433
Sequence:
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI
IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA
SSKIRRLSACKQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4567
NameBDBM4567
Synonyms:4-anilinoquinazoline deriv. 2 | BMC163482 Compound 1 | CHEMBL285063 | N-{4-[(3-bromophenyl)amino]quinazolin-6-yl}prop-2-enamide | US9422297, PD168393
TypeSmall organic molecule
Emp. Form.C17H13BrN4O
Mol. Mass.369.215
SMILESBrc1cccc(Nc2ncnc3ccc(NC(=O)C=C)cc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a