Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRAS guanyl releasing protein 3
LigandBDBM50244451
Substrate/Competitorn/a
Meas. Tech.ChEMBL_513189
Ki 0.70±n/a nM
Citation El Kazzouli, SLewin, NEBlumberg, PMMarquez, VE Conformationally constrained analogues of diacylglycerol. 30. An investigation of diacylglycerol-lactones containing heteroaryl groups reveals compounds with high selectivity for Ras guanyl nucleotide-releasing proteins. J Med Chem51:5371-86 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
RAS guanyl releasing protein 3
Name:RAS guanyl releasing protein 3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:78335.20
Organism:Homo sapiens (Human)
Description:ChEMBL_1364407
Residue:690
Sequence:
MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRV
HAGVDVVDRGTEFELDQDEGEETRQDGEDG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244451
NameBDBM50244451
Synonyms:(E)-(2-(hydroxymethyl)-4-((1-methyl-1H-indol-3-yl)methylene)-5-oxo-tetrahydrofuran-2-yl)methyl 2-isobutyl-4-methylpentanoate | CHEMBL488667
TypeSmall organic molecule
Emp. Form.C26H35NO5
Mol. Mass.441.5598
SMILESCC(C)CC(CC(C)C)C(=O)OCC1(CO)C\C(=C/c2cn(C)c3ccccc23)C(=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a