Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombopoietin receptor
LigandBDBM50265108
Substrate/Competitorn/a
Meas. Tech.ChEMBL_497069
EC50 25±n/a nM
Citation Marsilje, THAlper, PBLu, WMutnick, DMichellys, PYHe, YKaranewsky, DSChow, DGerken, ALao, JKim, MJSeidel, HMTian, SS Optimization of small molecule agonists of the thrombopoietin (Tpo) receptor derived from a benzo[a]carbazole hit scaffold. Bioorg Med Chem Lett18:5259-62 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombopoietin receptor
Name:Thrombopoietin receptor
Synonyms:C-mpl | CD_antigen=CD110 | Myeloproliferative leukemia protein | TPO-R
Type:PROTEIN
Mol. Mass.:71243.48
Organism:Homo sapiens
Description:ChEMBL_535587
Residue:635
Sequence:
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50265108
NameBDBM50265108
Synonyms:CHEMBL498581 | N-(7-(4-butylphenyl)-6-fluoro-5,10-dihydroindeno[1,2-b]indol-2-yl)acetamide
TypeSmall organic molecule
Emp. Form.C27H25FN2O
Mol. Mass.412.4986
SMILESCCCCc1ccc(cc1)-c1ccc2c3Cc4cc(NC(C)=O)ccc4-c3[nH]c2c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a