Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptors; A1 & A2a
LigandBDBM21172
Substrate/Competitorn/a
Meas. Tech.ChEMBL_492788
Ki 3±n/a nM
Citation Moorjani, MLuo, ZLin, EVong, BGChen, YZhang, XRueter, JKGross, RSLanier, MCTellew, JEWilliams, JPLechner, SMMalany, SSantos, MCrespo, MIDíaz, JLSaunders, JSlee, DH 2,6-Diaryl-4-acylaminopyrimidines as potent and selective adenosine A(2A) antagonists with improved solubility and metabolic stability. Bioorg Med Chem Lett18:5402-5 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptors; A1 & A2a
Name:Adenosine receptors; A1 & A2a
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (human)
Description:Expressed in CHO cells
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21172
NameBDBM21172
Synonyms:CHEMBL251975 | N-[2-(furan-2-yl)-6-(1H-pyrazol-1-yl)pyrimidin-4-yl]-2-(4-methylpiperazin-1-yl)acetamide | Pyrimidine analogue, 1
TypeSmall organic molecule
Emp. Form.C18H21N7O2
Mol. Mass.367.405
SMILESCN1CCN(CC(=O)Nc2cc(nc(n2)-c2ccco2)-n2cccn2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a