Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50277152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_540512
Ki 1.7±n/a nM
Citation Goodman, AJAjello, CWWorm, KLe Bourdonnec, BSavolainen, MAO'Hare, HCassel, JAStabley, GJDehaven, RNLabuda, CJKoblish, MLittle, PJBrogdon, BLSmith, SADolle, RE CB2 selective sulfamoyl benzamides: optimization of the amide functionality. Bioorg Med Chem Lett19:309-13 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277152
NameBDBM50277152
Synonyms:(1S,2S,4R)-1,3,3-trimethyl-N-(4-methyl-3-(morpholinosulfonyl)phenyl)bicyclo[2.2.1]heptane-2-carboxamide | CHEMBL515090
TypeSmall organic molecule
Emp. Form.C22H32N2O4S
Mol. Mass.420.565
SMILESCc1ccc(NC(=O)[C@H]2[C@@]3(C)CC[C@H](C3)C2(C)C)cc1S(=O)(=O)N1CCOCC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a