Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine Oxidase Type B (MAO-B)
LigandBDBM50247673
Substrate/Competitorn/a
Meas. Tech.ChEMBL_495008
IC50 399000±n/a nM
Citation Gökhan-Kelekçi, NKoyunoqlu, SYabanoqlu, SYesilada, KOzgen, OUçar, GErol, KKendi, EYesilada, A New pyrazoline bearing 4(3H)-quinazolinone inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity. Bioorg Med Chem17:675-89 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine Oxidase Type B (MAO-B)
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) B | Amine oxidase [flavin-containing] B | MAOB | Monoamine oxidase | Monoamine oxidase B (MAO-B) | Monoamine oxidase B (rMAO-B) | Monoamine oxidase type B (MAOB) | Monoamine oxidase-B (MAO-B)
Type:Enzyme
Mol. Mass.:58469.65
Organism:Rattus norvegicus (rat)
Description:P19643
Residue:520
Sequence:
MSNKCDVIVVGGGISGMAAAKLLHDCGLSVVVLEARDRVGGRTYTIRNKNVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHFVKGKSYAFRGPFPPVWNPITYLDYNNLWR
TMDEMGQEIPSDAPWKAPLAEEWDYMTMKELLDKICWTNSTKQIATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFIGGSGQVSERIKDILGDRVKLERPVIHIDQ
TGENVVVKTLNHEIYEAKYVISAIPPVLGMKIHHSPPLPILRNQLITRVPLGSVIKCMVY
YKEPFWRKKDFCGTMVIEGEEAPIAYTLDDTKPDGSCAAIMGFILAHKARKLVRLTKEER
LRKLCELYAKVLNSQEALQPVHYEEKNWCEEQYSGGCYTAYFPPGILTQYGRVLRQPVGK
IFFAGTETASHWSGYMEGAVEAGERAAREILHAIGKIPEDEIWQPEPESVDVPARPITNT
FLERHLPSVPGLLKLLGLTTILSATALGFLAHKKGLFVRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50247673
NameBDBM50247673
Synonyms:2-[1'-Phenyl-3'-(4-methoxyphenyl)-2'-propenylidene]hydrazine-3-methyl-4(3H)-quinazolinone | CHEMBL454379
TypeSmall organic molecule
Emp. Form.C25H22N4O2
Mol. Mass.410.4678
SMILESCOc1ccc(CC=C(N=Nc2nc3ccccc3c(=O)n2C)c2ccccc2)cc1 |w:7.6,10.10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a