Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombopoietin receptor
LigandBDBM50248023
Substrate/Competitorn/a
Meas. Tech.ChEMBL_543527
EC50 10±n/a nM
Citation Munchhof, MJAntipas, ASBlumberg, LCBrissette, WHBrown, MFCasavant, JMDoty, JLDriscoll, JHarris, TMWolf-Gouveia, LAJones, CSLi, QLinde, RGLira, PDMarfat, AMcElroy, EMitton-Fry, MMcCurdy, SPReiter, LARipp, SLShavnya, AThomasco, LMTrevena, KA The identification of orally bioavailable thrombopoietin agonists. Bioorg Med Chem Lett19:1428-30 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombopoietin receptor
Name:Thrombopoietin receptor
Synonyms:C-mpl | CD_antigen=CD110 | Myeloproliferative leukemia protein | TPO-R
Type:PROTEIN
Mol. Mass.:71243.48
Organism:Homo sapiens
Description:ChEMBL_535587
Residue:635
Sequence:
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50248023
NameBDBM50248023
Synonyms:1-(2,6-dichloro-4-(4-(2-fluoro-3-(trifluoromethyl)phenyl)thiazol-2-ylcarbamoyl)phenyl)piperidine-4-carboxylic acid | CHEMBL455654
TypeSmall organic molecule
Emp. Form.C23H17Cl2F4N3O3S
Mol. Mass.562.364
SMILESOC(=O)C1CCN(CC1)c1c(Cl)cc(cc1Cl)C(=O)Nc1nc(cs1)-c1cccc(c1F)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a