Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM50249446
Substrate/Competitorn/a
Meas. Tech.ChEMBL_499503
IC50 890±n/a nM
Citation Morley, ADKenny, PWBurton, BHeald, RAMacfaul, PAMullett, JPage, KPorres, SSRibeiro, LRSmith, PWard, SWilkinson, TJ 5-Aminopyrimidin-2-ylnitriles as cathepsin K inhibitors. Bioorg Med Chem Lett19:1658-61 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein
Type:Protein
Mol. Mass.:37507.38
Organism:Homo sapiens (Human)
Description:P25774
Residue:331
Sequence:
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50249446
NameBDBM50249446
Synonyms:5-amino-4-(isobutylamino)-6-(piperazin-1-yl)pyrimidine-2-carbonitrile | CHEMBL474484
TypeSmall organic molecule
Emp. Form.C13H21N7
Mol. Mass.275.3527
SMILESCC(C)CNc1nc(nc(N2CCNCC2)c1N)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a