Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase PIM
LigandBDBM50278836
Substrate/Competitorn/a
Meas. Tech.ChEMBL_565659
IC50 794±n/a nM
Citation Seefeld, MARouse, MBMcNulty, KCSun, LWang, JYamashita, DSLuengo, JIZhang, SMinthorn, EAConcha, NOHeerding, DA Discovery of 5-pyrrolopyridinyl-2-thiophenecarboxamides as potent AKT kinase inhibitors. Bioorg Med Chem Lett19:2244-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase PIM
Name:Serine/threonine-protein kinase PIM
Synonyms:PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase pim-1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:45417.87
Organism:Homo sapiens (Human)
Description:P11309
Residue:404
Sequence:
MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSH
SPRHSLRHSPGSGSCGSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGK
EKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPME
VVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFW
QVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSP
PEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRW
CLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50278836
NameBDBM50278836
Synonyms:CHEMBL523586 | N-((S)-1-amino-3-(3-fluorophenyl)propan-2-yl)-4-bromo-5-(1H-pyrrolo[2,3-b]pyridin-4-yl)thiophene-2-carboxamide
TypeSmall organic molecule
Emp. Form.C21H18BrFN4OS
Mol. Mass.473.361
SMILESNC[C@H](Cc1cccc(F)c1)NC(=O)c1cc(Br)c(s1)-c1ccnc2[nH]ccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a