Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLutropin-choriogonadotropic hormone receptor
LigandBDBM50256858
Substrate/Competitorn/a
Meas. Tech.ChEMBL_562591
IC50 2300±n/a nM
Citation Heitman, LHNarlawar, Rde Vries, HWillemsen, MNWolfram, DBrussee, JIjzerman, AP Substituted terphenyl compounds as the first class of low molecular weight allosteric inhibitors of the luteinizing hormone receptor. J Med Chem52:2036-42 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lutropin-choriogonadotropic hormone receptor
Name:Lutropin-choriogonadotropic hormone receptor
Synonyms:LCGR | LGR2 | LH/CG-R | LHCGR | LHR | LHRHR | LSH-R | Luteinizing hormone receptor
Type:PROTEIN
Mol. Mass.:78662.77
Organism:Homo sapiens (Human)
Description:ChEMBL_562598
Residue:699
Sequence:
MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLP
VKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFI
NLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLK
LYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSY
GLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
SKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAFNPCEDIMGYD
FLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRL
RHAILIMLGGWLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFF
IICACYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLIT
VTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAELYRRKDFSAYT
SNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50256858
NameBDBM50256858
Synonyms:CHEMBL474041 | Cyclopentyl-carbamic acid [1,1',3',1'']terphenyl-5'-yl ester
TypeSmall organic molecule
Emp. Form.C24H23NO2
Mol. Mass.357.4449
SMILESO=C(NC1CCCC1)Oc1cc(cc(c1)-c1ccccc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a