Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpoxide hydratase
LigandBDBM50278184
Substrate/Competitorn/a
Meas. Tech.ChEMBL_497574
IC50 59.1±n/a nM
Citation Xie, YLiu, YGong, GSmith, DHYan, FRinderspacher, AFeng, YZhu, ZLi, XDeng, SXBranden, LVidovic, DChung, CSchürer, SMorisseau, CHammock, BDLandry, DW Discovery of potent non-urea inhibitors of soluble epoxide hydrolase. Bioorg Med Chem Lett19:2354-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Epoxide hydratase
Name:Epoxide hydratase
Synonyms:Soluble epoxide hydrolase (sEH) | epoxide hydrolase 2, cytoplasmic
Type:Enzyme
Mol. Mass.:62613.07
Organism:Homo sapiens (Human)
Description:P34913
Residue:555
Sequence:
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG
YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK
WLDSDARNPPVVSKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50278184
NameBDBM50278184
Synonyms:CHEMBL469361 | N-(2,5-dichlorobenzyl)-1-(mesitylsulfonyl)piperidine-4-carboxamide
TypeSmall organic molecule
Emp. Form.C22H26Cl2N2O3S
Mol. Mass.469.424
SMILESCc1cc(C)c(c(C)c1)S(=O)(=O)N1CCC(CC1)C(=O)NCc1cc(Cl)ccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a