Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycine transporter 1
LigandBDBM50277866
Substrate/Competitorn/a
Meas. Tech.ChEMBL_501634
IC50 0.100000±n/a nM
Citation Thomson, JLBlackaby, WPJennings, ASGoodacre, SCPike, AThomas, SBrown, TASmith, APillai, GStreet, LJLewis, RT Optimisation of a series of potent, selective and orally bioavailable GlyT1 inhibitors. Bioorg Med Chem Lett19:2235-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycine transporter 1
Name:Glycine transporter 1
Synonyms:GlyT-1 | GlyT1 | Glycine Transporters (GlyT1c) | Sodium- and chloride-dependent glycine transporter 1 | Sodium- and chloride-dependent glycine transporter 1 (GlyT1) | Sodium- and chloride-dependent glycine transporter 1 (GlyT1c) | Sodium-and chloride-dependent glycine transporter 1 (GlyT-1c) | Solute carrier family 6 member 9
Type:Enzyme
Mol. Mass.:78270.54
Organism:Homo sapiens (Human)
Description:P48067
Residue:706
Sequence:
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKV
WHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGL
GNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKG
VGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTN
GSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLV
VFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKV
WGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF
MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETL
VTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVIS
CIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITY
NHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLE
HRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277866
NameBDBM50277866
Synonyms:2,4-dichloro-N-((3-(cyclopropylmethyl)-1-(1-methyl-1H-1,2,3-triazol-4-ylsulfonyl)azetidin-3-yl)methyl)benzamide | CHEMBL485356
TypeSmall organic molecule
Emp. Form.C18H21Cl2N5O3S
Mol. Mass.458.362
SMILESCn1cc(nn1)S(=O)(=O)N1CC(CNC(=O)c2ccc(Cl)cc2Cl)(CC2CC2)C1
Structure
n/a