Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50267638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_563542
Ki 80±n/a nM
Citation Brizzi, ABrizzi, VCascio, MGCorelli, FGuida, FLigresti, AMaione, SMartinelli, APasquini, STuccinardi, TDi Marzo, V New resorcinol-anandamide"hybrids" as potent cannabinoid receptor ligands endowed with antinociceptive activity in vivo. J Med Chem52:2506-14 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50267638
NameBDBM50267638
Synonyms:12-(3-hydroxy-5-(2-methyloctan-2-yl)phenoxy)-N-(2-hydroxyethyl)dodecanamide | CHEMBL490035
TypeSmall organic molecule
Emp. Form.C29H51NO4
Mol. Mass.477.7195
SMILESCCCCCCC(C)(C)c1cc(O)cc(OCCCCCCCCCCCC(=O)NCCO)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a