Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50267670
Substrate/Competitorn/a
Meas. Tech.ChEMBL_563546
IC50>10000±n/a nM
Citation Brizzi, ABrizzi, VCascio, MGCorelli, FGuida, FLigresti, AMaione, SMartinelli, APasquini, STuccinardi, TDi Marzo, V New resorcinol-anandamide"hybrids" as potent cannabinoid receptor ligands endowed with antinociceptive activity in vivo. J Med Chem52:2506-14 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:Brain-type cannabinoid receptor | CANNABINOID CB1 | CB-R | CB1 | Cannabinoid CB1 receptor | Cannabinoid receptor 1 (CB1)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52856.55
Organism:Rattus norvegicus (rat)
Description:P20272
Residue:473
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50267670
NameBDBM50267670
Synonyms:CHEMBL490046 | N-cyclopropyl-11-(3,5-dihydroxyphenoxy)undecanamide
TypeSmall organic molecule
Emp. Form.C20H31NO4
Mol. Mass.349.4644
SMILESOc1cc(O)cc(OCCCCCCCCCCC(=O)NC2CC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a