Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-3 adrenergic receptor
LigandBDBM50243112
Substrate/Competitorn/a
Meas. Tech.ChEMBL_497812
EC50 1.3±n/a nM
Citation Hattori, KToda, SImanishi, MItou, SNakajima, YWashizuka, KAraki, THamashima, HTomishima, YSakurai, MMatsui, SImamura, EUeshima, KYamamoto, TYamamoto, NIshikawa, HNakano, KUnami, NHamada, KMatsumura, YTakamura, F Discovery of highly potent and selective biphenylacylsulfonamide-based beta3-adrenergic receptor agonists and evaluation of physical properties as potential overactive bladder therapies: part 5. J Med Chem52:3063-72 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-3 adrenergic receptor
Name:Beta-3 adrenergic receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:43072.49
Organism:Canis familiaris
Description:ChEMBL_497812
Residue:405
Sequence:
MAPWPHGNGSVASWPAAPTPTPDAANTSGLPGAPWAVALAGALLALEVLATVGGNLLVIV
AIARTPRLQTMTNVFVTSLATADLVVGLLVVPPGATLALTGRWPLGATGCELWTSVDVLC
VTASIETLCALAVDRYLAVTNPLRYGALVTKRRARAAVVLVWVVSAAVSFAPIMSKWWRV
GADAEAQRCHSNPHCCAFASNIPYALLSSSVSFYLPLLVMLFVYARVFLVATRQLRLLRR
ELGRFPPAESPPAASRSRSPGPARRCASPAAVPSDRLRPARLLPLREHRALRTLGLIVGT
FTLCWLPFFVANVMRALGGPSLVPSPALLALNWLGYANSAFNPLIYCRSPDFRSAFRRLL
CRCRREEHRAAASPPGDPSAAPAALTSPAESSRCQALDGASWGIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50243112
NameBDBM50243112
Synonyms:(R)-3-(cyclohexyloxy)-4'-(2-(2-hydroxy-2-(pyridin-3-yl)ethylamino)ethyl)biphenyl-4-carboxylic acid | 3-(Cyclohexyloxy)-4-(2-{[(2R)-2-hydroxy-2-(3-pyridinyl)ethyl]amino}-ethyl)-4-biphenylcarboxylic acid | CHEMBL488224
TypeSmall organic molecule
Emp. Form.C28H32N2O4
Mol. Mass.460.5647
SMILESO[C@@H](CNCCc1ccc(cc1)-c1ccc(C(O)=O)c(OC2CCCCC2)c1)c1cccnc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a