Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVanilloid receptor
LigandBDBM50258473
Substrate/Competitorn/a
Meas. Tech.ChEMBL_499843
IC50>10000±n/a nM
Citation Li, FNKim, NJPaek, SMKwon, DYMin, KHJeong, YSKim, SYPark, YHKim, HDPark, HGSuh, YG Design, synthesis, and biological evaluation of novel diarylalkyl amides as TRPV1 antagonists. Bioorg Med Chem17:3557-67 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vanilloid receptor
Name:Vanilloid receptor
Synonyms:Capsaicin receptor | OTRPC1 | Transient receptor potential cation channel subfamily V member 1 (TRPV1) | Vanilloid Receptor 1 (TRPV1, VR1) | Vanilloid VR1 | Vanilloid receptor 1 (VRI/TRPV1) | Vanilloid receptor type 1-like | Vanilloid receptor type 1-like (TrpV1/Vr1) | osm-9-like TRP channel 1
Type:Transient Receptor
Mol. Mass.:94956.12
Organism:Rattus norvegicus (rat)
Description:O35433
Residue:838
Sequence:
MEQRASLDSEESESPPQENSCLDPPDRDPNCKPPPVKPHIFTTRSRTRLFGKGDSEEASP
LDCPYEEGGLASCPIITVSSVLTIQRPGDGPASVRPSSQDSVSAGEKPPRLYDRRSIFDA
VAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVA
RKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTK
GRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTVD
NTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIHEP
ECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPNRHDMLLVEPLNR
LLQDKWDRFVKRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVGDYFRVTGEIL
SVSGGVYFFFRGIQYFLQRRPSLKSLFVDSYSEILFFVQSLFMLVSVVLYFSQRKEYVAS
MVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIE
DGKNNSLPMESTPHKCRGSACKPGNSYNSLYSTCLELFKFTIGMGDLEFTENYDFKAVFI
ILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAF
RSGKLLQVGFTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVKRTLSFSLRSG
RVSGRNWKNFALVPLLRDASTRDRHATQQEEVQLKHYTGSLKPEDAEVFKDSMVPGEK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50258473
NameBDBM50258473
Synonyms:3-(2,2-Dimethyl-2,3-dihydrobenzofuran-5-yl)-N-(3-fluoro-4-(methylsulfonamido)benzyl)propanamide | CHEMBL466632
TypeSmall organic molecule
Emp. Form.C21H25FN2O4S
Mol. Mass.420.498
SMILESCC1(C)Cc2cc(CCC(=O)NCc3ccc(NS(C)(=O)=O)c(F)c3)ccc2O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a