Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-1
LigandBDBM11835
Substrate/Competitorn/a
Meas. Tech.ChEMBL_500013
IC50 61±n/a nM
Citation Grey, RPierce, ACBemis, GWJacobs, MDMoody, CSJajoo, RMohal, NGreen, J Structure-based design of 3-aryl-6-amino-triazolo[4,3-b]pyridazine inhibitors of Pim-1 kinase. Bioorg Med Chem Lett19:3019-22 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-1
Name:Serine/threonine-protein kinase PIM
Synonyms:PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:35681.82
Organism:Homo sapiens (Human)
Description:P11309
Residue:313
Sequence:
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11835
NameBDBM11835
Synonyms:1-(3-{6-[(cyclopropylmethyl)amino]imidazo[1,2-a]pyridazin-3-yl}phenyl)ethan-1-one | CHEMBL200528 | Cancer Res 676916 Compound K00135 | Imidazol[1,2-b]pyridazine 1
TypeSmall organic molecule
Emp. Form.C18H18N4O
Mol. Mass.306.3617
SMILESCC(=O)c1cccc(c1)-c1cnc2ccc(NCC3CC3)nn12
Structure
n/a