Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic receptor M2 and M3
LigandBDBM50258723
Substrate/Competitorn/a
Meas. Tech.ChEMBL_519765
EC50 2840±n/a nM
Citation Bridges, TMMarlo, JENiswender, CMJones, CKJadhav, SBGentry, PRPlumley, HCWeaver, CDConn, PJLindsley, CW Discovery of the first highly M5-preferring muscarinic acetylcholine receptor ligand, an M5 positive allosteric modulator derived from a series of 5-trifluoromethoxy N-benzyl isatins. J Med Chem52:3445-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic receptor M2 and M3
Name:Muscarinic receptor M1 and M2
Synonyms:CHRM2 | Cholinergic, muscarinic M2
Type:Enzyme Catalytic Domain
Mol. Mass.:51555.53
Organism:RAT
Description:Cholinergic, muscarinic 0 RAT::P10980
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50258723
NameBDBM50258723
Synonyms:7-chloro-1-(4-(trifluoromethyl)benzyl)indoline-2,3-dione | CHEMBL503735
TypeSmall organic molecule
Emp. Form.C16H9ClF3NO2
Mol. Mass.339.696
SMILESFC(F)(F)c1ccc(CN2C(=O)C(=O)c3cccc(Cl)c23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a