BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeutral alpha-glucosidase AB
LigandBDBM18351
Substrate/Competitorn/a
Meas. Tech.ChEMBL_218091
Ki 460000±n/a nM
Citation Berger, ADax, KGradnig, GGrassberger, VStütz, AEUngerank, MLegler, GBause, E Synthesis and biological activity of C-6 modified derivatives of the glucosidase inhibitor 1-deoxynojirimycin. Bioorg Med Chem Lett2:27-32 (1992)    Article
More Info.:Get all data from this article,  Assay Method
 
Neutral alpha-glucosidase AB
Name:Neutral alpha-glucosidase AB
Synonyms:Alpha-glucosidase 2 | Glucosidase II subunit alpha
Type:PROTEIN
Mol. Mass.:106864.62
Organism:Homo sapiens
Description:ChEMBL_218093
Residue:944
Sequence:
MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPY
RALLDSLQLGPDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLV
ADPPIARLSVSGRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEH
QRAPRVSQGSKDPAEGDGAQPEETPRDGDKPEETQGKAEKDEPGAWEETFKTHSDSKPYG
PMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLYNLDVFQYELYNPMALYGSVP
VLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQTDVRWMSETG
IIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHN
LPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVH
EELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVW
NDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVL
ARAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLGLVGLSFCGADVGGFFKNPEPELL
VRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHR
EGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQ
SYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTA
QGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKP
AAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18351
NameBDBM18351
Synonyms:(2R,3R,4R,5S)-2-(Hydroxymethyl)piperidine-3,4,5-triol, 10 | (2R,3R,4R,5S)-2-(hydroxymethyl)piperidine-3,4,5-triol | 1-Deoxynojirimycin | 1-deoxynojirimycin (DNJ) | CHEMBL307429 | US9181184, 1 | dNM
Typenatural product
Emp. Form.C6H13NO4
Mol. Mass.163.1717
SMILESOC[C@H]1NC[C@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM18351
Synonyms:(2R,3R,4R,5S)-2-(Hydroxymethyl)piperidine-3,4,5-triol, 10 | (2R,3R,4R,5S)-2-(hydroxymethyl)piperidine-3,4,5-triol | 1-Deoxynojirimycin | 1-deoxynojirimycin (DNJ) | CHEMBL307429 | US9181184, 1 | dNM
Typenatural product
Emp. Form.C6H13NO4
Mol. Mass.163.1717
SMILESOC[C@H]1NC[C@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: