BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoxygenase-1
LigandBDBM50280213
Substrate/Competitorn/a
Meas. Tech.ChEBML_101366
Ki 2000±n/a nM
Citation Wright, SWNelson, MJ Episulfide inhibitors of lipoxygenase Bioorg Med Chem Lett2:1385-1390 (1992)    Article
More Info.:Get all data from this article,  Assay Method
 
Lipoxygenase-1
Name:Seed lipoxygenase-1
Synonyms:15-LOX | 15-Lipo-oxygenase (15-LO) | 15-lipo-oxygenase (SLO) | Arachidonic Acid 15- Lipoxygenase | L-1 | Lipoxygenase (LOX) | Lipoxygenase (SLO) | Seed lipoxygenase-1
Type:Enzyme
Mol. Mass.:94365.66
Organism:Glycine max (soybean)
Description:n/a
Residue:839
Sequence:
MFSAGHKIKGTVVLMPKNELEVNPDGSAVDNLNAFLGRSVSLQLISATKADAHGKGKVGK
DTFLEGINTSLPTLGAGESAFNIHFEWDGSMGIPGAFYIKNYMQVEFFLKSLTLEAISNQ
GTIRFVCNSWVYNTKLYKSVRIFFANHTYVPSETPAPLVSYREEELKSLRGNGTGERKEY
DRIYDYDVYNDLGNPDKSEKLARPVLGGSSTFPYPRRGRTGRGPTVTDPNTEKQGEVFYV
PRDENLGHLKSKDALEIGTKSLSQIVQPAFESAFDLKSTPIEFHSFQDVHDLYEGGIKLP
RDVISTIIPLPVIKELYRTDGQHILKFPQPHVVQVSQSAWMTDEEFAREMIAGVNPCVIR
GLEEFPPKSNLDPAIYGDQSSKITADSLDLDGYTMDEALGSRRLFMLDYHDIFMPYVRQI
NQLNSAKTYATRTILFLREDGTLKPVAIELSLPHSAGDLSAAVSQVVLPAKEGVESTIWL
LAKAYVIVNDSCYHQLMSHWLNTHAAMEPFVIATHRHLSVLHPIYKLLTPHYRNNMNINA
LARQSLINANGIIETTFLPSKYSVEMSSAVYKNWVFTDQALPADLIKRGVAIKDPSTPHG
VRLLIEDYPYAADGLEIWAAIKTWVQEYVPLYYARDDDVKNDSELQHWWKEAVEKGHGDL
KDKPWWPKLQTLEDLVEVCLIIIWIASALHAAVNFGQYPYGGLIMNRPTASRRLLPEKGT
PEYEEMINNHEKAYLRTITSKLPTLISLSVIEILSTHASDEVYLGQRDNPHWTSDSKALQ
AFQKFGNKLKEIEEKLVRRNNDPSLQGNRLGPVQLPYTLLYPSSEEGLTFRGIPNSISI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50280213
NameBDBM50280213
Synonyms:(E)-11-(3-Pentyl-thiiranyl)-undec-9-enoic acid | CHEMBL283482
TypeSmall organic molecule
Emp. Form.C18H32O2S
Mol. Mass.312.51
SMILESCCCCCC1SC1C\C=C\CCCCCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a