BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50280563
Substrate/Competitorn/a
Meas. Tech.ChEBML_139630
IC50 59300±n/a nM
Citation Tecle, HMirzadegan, TMoos, WHMoreland, DWPavia, MRSchwarz, RDDavis, RE A rationale for the design and synthesis of m1 selective muscarinic agonists. Bioorg Med Chem Lett2:821-826 (1992)    Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50280563
NameBDBM50280563
Synonyms:1-Aza-bicyclo[2.2.1]heptan-3-one O-(4-methoxy-but-2-ynyl)-oxime | CHEMBL168991
TypeSmall organic molecule
Emp. Form.C11H16N2O2
Mol. Mass.208.2569
SMILESCOCC#CCO\N=C1/CN2CCC1C2 |THB:7:8:14:12.11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a