BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-CoA:cholesterol acyltransferase
LigandBDBM50281485
Substrate/Competitorn/a
Meas. Tech.ChEBML_28337
IC50 29±n/a nM
Citation Trivedi, BKStoeber, TLStanfield, RLEssenburg, ADHamelehle, KLKrause, BR Substituted N,N′-diphenyl ureas as potent inhibitors of acyl-CoA:Cholesterol acyltransferase (ACAT) Bioorg Med Chem Lett3:259-262 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-CoA:cholesterol acyltransferase
Name:Acyl-CoA:cholesterol acyltransferase
Synonyms:ACAT
Type:n/a
Mol. Mass.:35405.31
Organism:Oryctolagus cuniculus
Description:n/a
Residue:305
Sequence:
PLFLKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILKEMKNNHRAKDLRAPPEQGKIF
VARRSLLDELFEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFNLLSYAFGKLP
TVVWTWWTMFLSTLSIPYFLFQHWANGYSKSSHPLMYSLFHGLLFMVFQLGILGFGPTYI
VLAYTLPPASRFIVILEQIRLIMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLF
APTLIYRDSYPRTPTVRWGYVAMQFAQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVL
VLCIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281485
NameBDBM50281485
Synonyms:1-(4-Butyl-phenyl)-3-(2,6-diisopropyl-phenyl)-urea | CHEMBL89544
TypeSmall organic molecule
Emp. Form.C23H32N2O
Mol. Mass.352.513
SMILESCCCCc1ccc(NC(=O)Nc2c(cccc2C(C)C)C(C)C)cc1
Structure
n/a