BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurotensin receptor 1
LigandBDBM50281791
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144293
Ki 0.013000±n/a nM
Citation Henry, JAHorwell, DCMeecham, KGRees, DC A structure-affinity study of the amino acid side-chains in neurotensin : N and C terminal deletions and Ala-scan Bioorg Med Chem Lett3:949-952 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Neurotensin receptor 1
Name:Neurotensin receptor 1
Synonyms:NT-R-1 | Neurotensin 1 | Neurotensin receptor type 1
Type:Enzyme Catalytic Domain
Mol. Mass.:47237.04
Organism:MOUSE
Description:Neurotensin 1 NTSR1 MOUSE::A2ACT4
Residue:424
Sequence:
MHLNSSVQQGAPSEPGAQPFPHPQFGLETMLLALSLSNGSGNSSESILEPNSNLDVNTDI
YSKVLVTAVYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAM
PVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLM
SRSRTKKFISAIWLASALLAVPMLFTMGLQNRSADGQHPGGLVCTPTVDTATVKVVIQVN
TFMSFLFPMLIISILNTVIANKLTVMVHQAAEQGRGVCTVGTHNSLEHSTFNMSIEPGRV
QALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALFYV
SSAINPILYNLVSANFRQVFLSTLACLCPGWRRRRKKRPTFSRKPNSMSSNHAFSTSATR
ETLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281791
NameBDBM50281791
Synonyms:Ac-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH | CHEMBL405151
TypeSmall organic molecule
Emp. Form.C55H91N17O13
Mol. Mass.1198.4171
SMILESCC[C@@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(C)=O)C(=O)N[C@@H](CC(C)C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a