BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II type 1a (AT-1a) receptor
LigandBDBM50006909
Substrate/Competitorn/a
Meas. Tech.ChEMBL_36163
IC50 22±n/a nM
Citation Yanagisawa, HAmemiya, YKanazaki, TFujimoto, KShimoji, YFujimoto, YSada, TMizuno, MKoike, H Angiotensin II receptor antagonists: imidazoles and pyrroles bearing hydroxymethyl and carboxy substituents Bioorg Med Chem Lett4:177-182 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II type 1a (AT-1a) receptor
Name:Angiotensin II type 1a (AT-1a) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41107.81
Organism:Bos taurus
Description:ChEMBL_36779
Residue:359
Sequence:
MILNSSTEDGIKRIQDDCPKAGRHNYIFIMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVC
AFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKTLKKAYEIQKNKPRKDDIFK
IILAIVLFFFFSWVPHQIFTFMDVLIQLGLIRDCKIEDIVDTAMPITICLAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSENGNSSTKKPAPCIEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006909
NameBDBM50006909
Synonyms:2-Butyl-5-chloro-3-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazole-4-carboxylic acid | 2-Butyl-5-chloro-3-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazole-4-carboxylic acid (EXP3174) | 2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazole-4-carboxylic acid | 2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazole-4-carboxylic acid (EXP3174) | CHEMBL907 | Carboxylic Acid Metabolite (E-3174) | E 3174 | EXP3174
TypeSmall organic molecule
Emp. Form.C22H21ClN6O2
Mol. Mass.436.894
SMILESCCCCc1nc(Cl)c(C(O)=O)n1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a