BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT2
LigandBDBM50282452
Substrate/Competitorn/a
Meas. Tech.ChEMBL_35561
IC50 7.4±n/a nM
Citation Glinka, TWde Laszlo, SESiegl, PKChang, RSKivlighn, SDSchorn, TSFaust, KAChen, TBZingaro, GJLotti, VJGreenlee, WJ A new class of balanced AT1/AT2 angiotensin II antagonists: quinazolinone AII antagonists with acylsulfonamide and sulfonylcarbamate acidic functionalities Bioorg Med Chem Lett4:81-86 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II AT2
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41346.62
Organism:RAT
Description:Angiotensin II AT2 0 0::P35351
Residue:363
Sequence:
MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDT
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50282452
NameBDBM50282452
Synonyms:CHEMBL169488 | Quinazolinone Analog
TypeSmall organic molecule
Emp. Form.C33H39N5O6S
Mol. Mass.633.758
SMILESCCCCOC(=O)NS(=O)(=O)c1ccccc1-c1ccc(Cn2c(CCCC)nc3ccc(NC(=O)NCC)cc3c2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a