BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50282868
Substrate/Competitorn/a
Meas. Tech.ChEBML_64002
Ki 0.700000±n/a nM
Citation Hlasta, DJBell, MRBoaz, NWCourt, JJDesai, RCFranke, CAMura, AJSubramanyam, CDunlap, RP A benzisothiazolone class of potent, selective mechanism-based inhibitors of human leukocyte elastase Bioorg Med Chem Lett4:1801-1806 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50282868
NameBDBM50282868
Synonyms:1,1-Dioxo-2-(1-phenyl-1H-tetrazol-5-ylsulfanylmethyl)-4-propyl-1,2-dihydro-1lambda*6*-benzo[d]isothiazol-3-one | CHEMBL299656
TypeSmall organic molecule
Emp. Form.C18H17N5O3S2
Mol. Mass.415.489
SMILESCCCc1cccc2c1C(=O)N(CSc1nnnn1-c1ccccc1)S2(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a