BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II receptor
LigandBDBM50049181
Substrate/Competitorn/a
Meas. Tech.ChEBML_35429
IC50 60±n/a nM
Citation Glinka, TWde Laszlo, SESiegl, PKChang, RSKivlighn, SDSchorn, TSFaust, KAChen, TBZingaro, GJLotti, VJGreenlee, WJ Development of angiotensin II antagonists with equipotent affinity for human AT1 and AT2 receptor subtypes. Bioorg Med Chem Lett4:2337-2342 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II receptor
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Angiotensin II, central | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41201.61
Organism:Homo sapiens (Human)
Description:Angiotensin II, central 0 0::P50052
Residue:363
Sequence:
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50049181
NameBDBM50049181
Synonyms:2-Butyl-3-(2'-(butyloxycarbonylaminosulphonyl)-biphenyl-4-ylmethyl)-6-(N-isopropyl-N-methyl-aminocarbonylamino)-3H-quinazolin-4-one | 4'-[2-Butyl-6-(3-isopropyl-3-methyl-ureido)-4-oxo-4H-quinazolin-3-ylmethyl]-biphenyl-2-sulfonic acid butyloxycarbonylamide(LP-162,393) | CHEMBL74476 | L-162393 | Quinazolinone Analog
TypeSmall organic molecule
Emp. Form.C35H43N5O6S
Mol. Mass.661.811
SMILESCCCCOC(=O)NS(=O)(=O)c1ccccc1-c1ccc(Cn2c(CCCC)nc3ccc(NC(=O)N(C)C(C)C)cc3c2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a