BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II type 1a (AT-1a) receptor
LigandBDBM50049181
Substrate/Competitorn/a
Meas. Tech.ChEBML_34645
IC50 0.240000±n/a nM
Citation Glinka, TWde Laszlo, SESiegl, PKChang, RSKivlighn, SDSchorn, TSFaust, KAChen, TBZingaro, GJLotti, VJGreenlee, WJ Development of angiotensin II antagonists with equipotent affinity for human AT1 and AT2 receptor subtypes. Bioorg Med Chem Lett4:2337-2342 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II type 1a (AT-1a) receptor
Name:Angiotensin II type 1a (AT-1a) receptor
Synonyms:ANGIOTENSIN AT1 | Angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41009.15
Organism:RABBIT
Description:ANGIOTENSIN AT1 AGTR1 RABBIT::P34976
Residue:359
Sequence:
MMLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLAVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50049181
NameBDBM50049181
Synonyms:2-Butyl-3-(2'-(butyloxycarbonylaminosulphonyl)-biphenyl-4-ylmethyl)-6-(N-isopropyl-N-methyl-aminocarbonylamino)-3H-quinazolin-4-one | 4'-[2-Butyl-6-(3-isopropyl-3-methyl-ureido)-4-oxo-4H-quinazolin-3-ylmethyl]-biphenyl-2-sulfonic acid butyloxycarbonylamide(LP-162,393) | CHEMBL74476 | L-162393 | Quinazolinone Analog
TypeSmall organic molecule
Emp. Form.C35H43N5O6S
Mol. Mass.661.811
SMILESCCCCOC(=O)NS(=O)(=O)c1ccccc1-c1ccc(Cn2c(CCCC)nc3ccc(NC(=O)N(C)C(C)C)cc3c2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a