BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEDNRA
LigandBDBM50284011
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63350
IC50 3500±n/a nM
Citation Cody, WLHe, JXDePue, PLRapundalo, STHingorani, GPDudley, DTHill, KEReynolds, EEDoherty, AM Structure-activity relationships in a series of monocyclic endothelin analogues Bioorg Med Chem Lett4:567-572 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
EDNRA
Name:Endothelin receptor
Synonyms:ENDOTHELIN A | Endothelin receptor | Endothelin-1 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48256.91
Organism:RAT
Description:ENDOTHELIN A EDNRA RAT::P26684
Residue:426
Sequence:
MGVLCFLASFWLALVGGAIADNAERYSANLSSHVEDFTPFPGTEFNFLGTTLQPPNLALP
SNGSMHGYCPQQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEQHRTCM
LNATTKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSS
HKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284011
NameBDBM50284011
Synonyms:CHEMBL438768 | Trp-Ile-Ile-Asp-Leu-Hisc(Cys-Ser-Asp-Lys-Glu-Val-Tyr-Phe-Cys)
TypeSmall organic molecule
Emp. Form.C86H121N19O24S2
Mol. Mass.1869.124
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](Cc2ccc(O)cc2)C(=O)N[C@@H](Cc2ccccc2)C(=O)N1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a