BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSterol O-acyltransferase, Soat
LigandBDBM50033969
Substrate/Competitorn/a
Meas. Tech.ChEBML_28360
IC50 10±n/a nM
Citation Wilde, RGBillheimer, JT Acyl CoA:cholesterol acyltransferase (ACAT) inhibitors: ureas bearing two heterocyclic head groups Bioorg Med Chem Lett5:173-6 (1995)  
More Info.:Get all data from this article,  Assay Method
 
Sterol O-acyltransferase, Soat
Name:Sterol O-acyltransferase, Soat
Synonyms:ACAT-1 | Cholesterol acyltransferase 1
Type:PROTEIN
Mol. Mass.:64165.56
Organism:Rattus norvegicus
Description:ChEMBL_28796
Residue:545
Sequence:
MVGEETSLRNRLSRSAENPEQDEAQKNLLDTHRNGHITMKQLIAKKRQLAAEAEELKPLF
LKEVGCHFDDFVTNLIDKSASLDNGGCALTTFSILEEMKNNHRAKDLRAPPEQGKIFISR
RSLLDELFEVDHIRTIYHMFIALLIIFILSTLVVDYIDEGRLVLEFSLLAYAFGQFPIVI
WTWWAMFLSTLAIPYFLFQRWAHGYSKSSHPLIYSLIHGAFFLVFQLGILGFIPTYVVLA
YTLPPASRFILILEQIRLVMKAHSYVRENVPRVLSAAKEKSSTVPVPTVNQYLYFLFAPT
LIYRDSYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLC
VFNSILPGVLMLFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVH
DWLYYYVYKDLLWFFSKRFRPAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGMA
FNFIVNDSRKRPVWNIMVRASLFLGHGVILCFYSQEWYARQRCPLKNPTFLDYVRPRTWT
CRYVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50033969
NameBDBM50033969
Synonyms:3-(2,4-Difluoro-phenyl)-1-[5-(4,5-diphenyl-1H-imidazol-2-ylsulfanyl)-pentyl]-1-heptyl-urea | CHEMBL274185 | Lecimibide
TypeSmall organic molecule
Emp. Form.C34H40F2N4OS
Mol. Mass.590.769
SMILESCCCCCCCN(CCCCCSc1nc(c([nH]1)-c1ccccc1)-c1ccccc1)C(=O)Nc1ccc(F)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a