BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Receptors A2a (A2a)
LigandBDBM50009709
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30902
IC50 19200±n/a nM
Citation Chebib, MQuinn, RJ Pyrazolo[3,4-d]pyrimidines; adenosine receptor selectivity Bioorg Med Chem Lett5:2409-2412 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine Receptors A2a (A2a)
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009709
NameBDBM50009709
Synonyms:4-Amino-5-butyl-1-(3-chloro-phenyl)-1,5-dihydro-pyrazolo[3,4-d]pyrimidin-6-one | CHEMBL310377
TypeSmall organic molecule
Emp. Form.C15H16ClN5O
Mol. Mass.317.773
SMILESCCCCn1c(N)c2cnn(-c3cccc(Cl)c3)c2nc1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a