BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50286044
Substrate/Competitorn/a
Meas. Tech.ChEBML_155151
Ki 28±n/a nM
Citation Sheppard, GSDavidsen, SKCarrera, GMPireh, DHolms, JHHeyman, HRSteinman, DHCurtin, MLConway, RGRhein, DAAlbert, DHTapang, PMagoc, TJSummers, JB Synthesis and evaluation of water soluble indole pyrrolothiazole paf antagonists Bioorg Med Chem Lett5:2913-2918 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50286044
NameBDBM50286044
Synonyms:CHEMBL320371 | [6-(4-Fluoro-phenyl)-3-((R)-3-pyridin-3-yl-1H-pyrrolo[1,2-c]thiazole-7-carbonyl)-indol-1-yl]-(4-methyl-piperazin-1-yl)-methanone
TypeSmall organic molecule
Emp. Form.C32H28FN5O2S
Mol. Mass.565.66
SMILESCN1CCN(CC1)C(=O)n1cc(C(=O)c2ccn3[C@H](SCc23)c2cccnc2)c2ccc(cc12)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a