BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50282868
Substrate/Competitorn/a
Meas. Tech.ChEMBL_86690
Ki 0.700000±n/a nM
Citation Hlasta, DJBell, MRCourt, JJCundy, KCDesai, RCFerguson, EWGordon, RJKumar, VMaycock, ALSubramanyam, CDunlap, RPEiff, SLFranke, CAMura, AJRowlands, AG The design of potent and stable benzisothiazolone inhibitors of human leukocyte elastase Bioorg Med Chem Lett5:331-336 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50282868
NameBDBM50282868
Synonyms:1,1-Dioxo-2-(1-phenyl-1H-tetrazol-5-ylsulfanylmethyl)-4-propyl-1,2-dihydro-1lambda*6*-benzo[d]isothiazol-3-one | CHEMBL299656
TypeSmall organic molecule
Emp. Form.C18H17N5O3S2
Mol. Mass.415.489
SMILESCCCc1cccc2c1C(=O)N(CSc1nnnn1-c1ccccc1)S2(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a