BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C alpha type
LigandBDBM50175491
Substrate/Competitorn/a
Meas. Tech.ChEBML_153129
IC50>100000±n/a nM
Citation Zimmermann, JBuchdunger, EMett, HMeyer, TLydon, NBTraxler, P Phenylamino-pyrimidine (PAP) — derivatives: a new class of potent and highly selective PDGF-receptor autophosphorylation inhibitors Bioorg Med Chem Lett6:1221-1226 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C alpha type
Name:PKC alpha and beta-2
Synonyms:PKC alpha | PKC-A | PKC-alpha | Protein Kinase C- alpha | Protein kinase C alpha | Protein kinase C alpha (PKCa) | Protein kinase C alpha type (PKC-A) | Protein kinase C alpha type (PRKCA) | Proto-oncogene c-RAF | RAF proto-oncogene serine/threonine-protein kinase
Type:Enzyme
Mol. Mass.:76755.65
Organism:Homo sapiens (human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:672
Sequence:
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50175491
NameBDBM50175491
Synonyms:4-Methyl-N-[4-methyl-3-(4-pyridin-3-yl-pyrimidin-2-ylamino)-phenyl]-benzamide | CHEMBL20867
TypeSmall organic molecule
Emp. Form.C24H21N5O
Mol. Mass.395.4564
SMILESCc1ccc(cc1)C(=O)Nc1ccc(C)c(Nc2nccc(n2)-c2cccnc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM50175491
Synonyms:4-Methyl-N-[4-methyl-3-(4-pyridin-3-yl-pyrimidin-2-ylamino)-phenyl]-benzamide | CHEMBL20867
TypeSmall organic molecule
Emp. Form.C24H21N5O
Mol. Mass.395.4564
SMILESCc1ccc(cc1)C(=O)Nc1ccc(C)c(Nc2nccc(n2)-c2cccnc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: