BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50009864
Substrate/Competitorn/a
Meas. Tech.ChEBML_46993
Ki 14±n/a nM
Citation Gallant, MDufresne, CGareau, YGuay, DLeblanc, YPrasit, PRochette, CSawyer, NSlipetz, DMTremblay, NMetters, KMLabelle, M New class of potent ligands for the human peripheral cannabinoid receptor Bioorg Med Chem Lett6:2263-2268 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009864
NameBDBM50009864
Synonyms:CHEMBL274833 | [2-Methyl-1-(2-morpholin-4-yl-ethyl)-1H-indol-3-yl]-naphthalen-1-yl-methanone
TypeSmall organic molecule
Emp. Form.C26H26N2O2
Mol. Mass.398.4968
SMILESCc1c(C(=O)c2cccc3ccccc23)c2ccccc2n1CCN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a