BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic elastase
LigandBDBM50029703
Substrate/Competitorn/a
Meas. Tech.ChEBML_158078
Ki>1000±n/a nM
Citation Hlasta, DJCourt, JJDesai, RCTalomie, TGShen, JDunlap, RPand, CAMura, AJ A comparative SAR and computer modeling study of benzisothiazolone, mechanism-based inhibitors with porcine pancreatic and human leukocyte elastase Bioorg Med Chem Lett6:2941-2946 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Pancreatic elastase
Name:Pancreatic elastase
Synonyms:Elastase 2A | Elastase-2 | Elastase-2A
Type:PROTEIN
Mol. Mass.:28705.23
Organism:Sus scrofa
Description:ChEMBL_156951
Residue:269
Sequence:
MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029703
NameBDBM50029703
Synonyms:4-Isopropyl-6-methoxy-1,1-dioxo-2-(1-phenyl-1H-tetrazol-5-ylsulfanylmethyl)-1,2-dihydro-1lambda*6*-benzo[d]isothiazol-3-one | CHEMBL98422 | WIN-63395
TypeSmall organic molecule
Emp. Form.C19H19N5O4S2
Mol. Mass.445.515
SMILESCOc1cc2c(C(=O)N(CSc3nnnn3-c3ccccc3)S2(=O)=O)c(c1)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a