BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-galactosidase
LigandBDBM50288852
Substrate/Competitorn/a
Meas. Tech.ChEBML_215880
IC50>1000000±n/a nM
Citation Igarashi, YIchikawa, MIchikawa, Y Synthesis of a new inhibitor of α-fucosidase Bioorg Med Chem Lett6:553-558 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Beta-galactosidase
Name:Beta-galactosidase
Synonyms:Acid beta-galactosidase | Elastin receptor 1 | Lactase
Type:PROTEIN
Mol. Mass.:76074.43
Organism:Homo sapiens
Description:ChEMBL_215886
Residue:677
Sequence:
MPGFLVRILPLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRV
PRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVIL
RPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPV
ITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTV
DFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARG
ASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKV
PEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRT
TLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENM
GRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWA
HNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLT
LFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKR
LMPPPPQKNKDSWLDHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50288852
n/a
NameBDBM50288852
Synonyms:5-Methoxy-piperidine-3,4-diol | CHEMBL414447
TypeSmall organic molecule
Emp. Form.C6H13NO3
Mol. Mass.147.1723
SMILESCOC1CNCC(O)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: