BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Receptors A2a (A2a)
LigandBDBM50290168
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30920
Ki 2.2±n/a nM
Citation Shimada, JKoike, NNonaka, HShiozaki, SYanagawa, KKanda, TKobayashi, HIchimura, MNakamura, JKase, HSuzuki, F Adenosine A2A antagonists with potent anti-cataleptic activity Bioorg Med Chem Lett7:2349-2352 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine Receptors A2a (A2a)
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290168
NameBDBM50290168
Synonyms:1,3-Diethyl-7-methyl-8-[(E)-2-(2,3,4-trimethoxy-phenyl)-vinyl]-3,7-dihydro-purine-2,6-dione | CHEMBL77699
TypeSmall organic molecule
Emp. Form.C21H26N4O5
Mol. Mass.414.4549
SMILESCCn1c2nc(\C=C\c3ccc(OC)c(OC)c3OC)n(C)c2c(=O)n(CC)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a