BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma
LigandBDBM50290188
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197229
Ki 7±n/a nM
Citation Farmer, LJJeong, SKallel, EAKoch, SSCroston, GEFlatten, KSHeyman, RANadzan, AM Synthesis and structure-activity relationships of potent retinoid X receptor ligands Bioorg Med Chem Lett7:2393-2398 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma
Name:Retinoid X receptor gamma
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:50900.28
Organism:Mus musculus
Description:ChEMBL_196589
Residue:463
Sequence:
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSVALPTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSSHEDMPVERIL
EAELAVEPKTESYGDMNVENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDSFLMEMLETPLQIT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290188
NameBDBM50290188
Synonyms:(2E,4E)-3-Methyl-5-[(1S,2R)-1-methyl-2-(5,5,8,8-tetramethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-cyclopentyl]-penta-2,4-dienoic acid | CHEMBL75814
TypeSmall organic molecule
Emp. Form.C26H36O2
Mol. Mass.380.5628
SMILESC\C(\C=C\[C@]1(C)CCC[C@@H]1c1ccc2c(c1)C(C)(C)CCC2(C)C)=C/C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a