BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM50290659
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196638
Ki 7±n/a nM
Citation Farmer, LJZhi, LJeong, SKallel, EACroston, GFlatten, KSHeyman, RANadzan, AM Synthesis and structure-activity relationships of potent conformationally restricted retinoid X receptor ligands Bioorg Med Chem Lett7:2747-2752 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoid receptor
Synonyms:Nuclear receptor subfamily 2 group B member 2 | Retinoic acid receptor RXR-beta | Retinoid X receptor beta
Type:PROTEIN
Mol. Mass.:56932.89
Organism:Homo sapiens (Human)
Description:ChEMBL_39045
Residue:533
Sequence:
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYP
EQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290659
NameBDBM50290659
Synonyms:(2E,4E)-3-Methyl-5-[1-(5,5,8,8-tetramethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-cyclopropyl]-penta-2,4-dienoic acid | CHEMBL93518
TypeSmall organic molecule
Emp. Form.C23H30O2
Mol. Mass.338.4831
SMILESC\C(\C=C\C1(CC1)c1ccc2c(c1)C(C)(C)CCC2(C)C)=C/C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a