BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet-derived growth factor receptor (PDGFr)
LigandBDBM50290836
Substrate/Competitorn/a
Meas. Tech.ChEBML_177425
IC50 21500±n/a nM
Citation Kubo, KShimizu, TOhyama, SiMurooka, HNishitoba, TKato, SKobayashi, YYagi, MIsoe, TNakamura, KOsawa, TIzawa, T A novel series of 4-phenoxyquinolines: potent and highly selective inhibitors of PDGF receptor autophosphorylation Bioorg Med Chem Lett7:2935-2940 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Platelet-derived growth factor receptor (PDGFr)
Name:Platelet-derived growth factor receptor (PDGFr)
Synonyms:Beta-type platelet-derived growth factor receptor | CD140 antigen-like family member B | CD_antigen=CD140b | PDGF-R-beta | Platelet-derived growth factor receptor beta | Platelet-derived growth factor receptor beta (PDGFRB)
Type:PROTEIN
Mol. Mass.:122794.58
Organism:Rattus norvegicus
Description:ChEMBL_177425
Residue:1097
Sequence:
MGLPEVMPASVLRGQLLLFVLLLLGPQISQGLVITPPGPEFVLNISSTFVLTCSSSAPVM
WEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVP
DPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIG
TFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGND
VVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHG
DEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSS
AGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLE
LSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVT
FWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFKVVVISAILAL
VVLTVISLIILIMLWQRKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSTELYSNALP
VGLSLPSHLNLTGESDGGYMDMSKDESVDYVPMLDMKGHIKYADIESSSYMAPYDNYVPS
APERTYRATLINDSPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGLHSLRSPLDTSSVLYTAVQPNETDNDY
IIPLPDPKPDAADEGLLEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQAEPEAQLEQP
QDSGCPGPLAEAEDSFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290836
NameBDBM50290836
Synonyms:(3-Bromo-phenyl)-(6,7-dimethoxy-quinolin-4-yl)-amine | CHEMBL98248
TypeSmall organic molecule
Emp. Form.C17H15BrN2O2
Mol. Mass.359.217
SMILESCOc1cc2nccc(Nc3cccc(Br)c3)c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a