BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50029257
Substrate/Competitorn/a
Meas. Tech.ChEBML_62923
Ki 1.8±n/a nM
Citation Baxter, EWReitz, AB Hindered rotation congeners of mazapertine: High affinity ligands for the 5-HT1A receptor Bioorg Med Chem Lett7:763-768 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029257
NameBDBM50029257
Synonyms:(3-((4-(2-isopropoxyphenyl)piperazin-1-yl)methyl)phenyl)(piperidin-1-yl)methanone | CHEMBL10085 | RWJ-377796 | mazapertine | {3-[4-(2-Isopropoxy-phenyl)-piperazin-1-ylmethyl]-phenyl}-piperidin-1-yl-methanone
TypeSmall organic molecule
Emp. Form.C26H35N3O2
Mol. Mass.421.575
SMILESCC(C)Oc1ccccc1N1CCN(Cc2cccc(c2)C(=O)N2CCCCC2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a