BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50291393
Substrate/Competitorn/a
Meas. Tech.ChEBML_140121
Ki 111±n/a nM
Citation Kassiou, MRead, RWShi, Xq Synthesis and evaluation of halogenated dibenzodiazepines as muscarinic receptor ligands Bioorg Med Chem Lett7:799-804 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291393
NameBDBM50291393
Synonyms:CHEMBL168145 | N-Ethyl-3-iodo-N-(4-{1-[2-oxo-2-(11-oxo-10,11-dihydro-dibenzo[b,e][1,4]diazepin-5-yl)-ethyl]-piperidin-4-yl}-butyl)-benzamide
TypeSmall organic molecule
Emp. Form.C33H37IN4O3
Mol. Mass.664.5763
SMILESCCN(CCCCC1CCN(CC(=O)N2c3ccccc3NC(=O)c3ccccc23)CC1)C(=O)c1cccc(I)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a