BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-1 receptor
LigandBDBM50291478
Substrate/Competitorn/a
Meas. Tech.ChEBML_65628
IC50 1200±n/a nM
Citation Raju, BOkun, IStavros, FChan, MF Search for surrogates: A study of endothelin receptor antagonist structure activity relationships Bioorg Med Chem Lett7:933-938 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Endothelin-1 receptor
Name:Endothelin receptor, ET-A/ET-B
Synonyms:EDNRA | ET-A | ETA | ETA-R | ETRA | Endothelin receptor type A | hET-AR
Type:Enzyme Catalytic Domain
Mol. Mass.:48736.88
Organism:Homo sapiens (Human)
Description:P25101
Residue:427
Sequence:
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291478
NameBDBM50291478
Synonyms:2-p-Tolyloxymethyl-thiophene-3-sulfonic acid (4-bromo-3-methyl-isoxazol-5-yl)-amide | CHEMBL172538
TypeSmall organic molecule
Emp. Form.C16H15BrN2O4S2
Mol. Mass.443.335
SMILESCc1noc(NS(=O)(=O)c2ccsc2COc2ccc(C)cc2)c1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a