Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase transforming protein Abl
LigandBDBM50292492
Substrate/Competitorn/a
Meas. Tech.ChEMBL_506213
IC50 1±n/a nM
Citation Chang, CJGeahlen, RL Protein-Tyrosine Kinase Inhibition: Mechanism-Based Discovery of Antitumor Agents J Nat Prod55:1529-1560 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase transforming protein Abl
Name:Tyrosine-protein kinase transforming protein Abl
Synonyms:ABL | Tyrosine-protein kinase V-ABL
Type:Enzyme
Mol. Mass.:81895.89
Organism:Abelson murine leukemia virus
Description:P00521
Residue:746
Sequence:
YITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHY
RINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDK
WEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIK
HPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYL
EKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYN
KFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRA
CWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRGTRGGAGSMLQAPELPTKTRT
CRRAAEQKASPPSLTPKLLRRQVTASPSSGLSHKKEATKGSASGMGTPATAEPAPPSNKV
GLSKASSEEMRVRRHKHSSESPGRDKGRLAKLKPAPPPPPACTGKAGKPAQSPSQEAGEA
GGPTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQSTAKPPGTPTSPVSTPST
APAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAIS
RNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLESNLRELQICPATA
SSGPAATQDFSKLLSSVKEISDIVRR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50292492
NameBDBM50292492
Synonyms:((2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl 4-(4-(2-acetamido-3-amino-3-oxopropyl)phenoxysulfonyl)benzoate | CHEMBL508477
TypeSmall organic molecule
Emp. Form.C28H29N7O10S
Mol. Mass.655.636
SMILESCC(=O)NC(Cc1ccc(OS(=O)(=O)c2ccc(cc2)C(=O)OC[C@H]2O[C@H]([C@H](O)[C@@H]2O)n2cnc3c(N)ncnc23)cc1)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a