Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNitric oxide synthase, endothelial
LigandBDBM50292749
Substrate/Competitorn/a
Meas. Tech.ChEMBL_493908
IC50 90000±n/a nM
Citation Maccallini, CPatruno, ABesker, NAlì, JIAmmazzalorso, ADe Filippis, BFranceschelli, SGiampietro, LPesce, MReale, MTricca, MLRe, NFelaco, MAmoroso, R Synthesis, biological evaluation, and docking studies of N-substituted acetamidines as selective inhibitors of inducible nitric oxide synthase. J Med Chem52:1481-5 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nitric oxide synthase, endothelial
Name:Nitric oxide synthase, endothelial
Synonyms:Constitutive NOS | Endothelial NOS | Endothelial nitric oxide synthase | NOS type III | Nitric oxide synthase (inducible and endothelial) | Nitric oxide synthase, endothelial (eNOS) | Nitric-oxide synthase (endothelial and brain) | cNOS | eNOS
Type:Enzyme Catalytic Domain
Mol. Mass.:133297.84
Organism:Homo sapiens (Human)
Description:P29474
Residue:1203
Sequence:
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT
QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP
EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50292749
NameBDBM50292749
Synonyms:1-[(1-Propionylpiperidin-4-yl)amino]ethaniminium bromide | CHEMBL473674
TypeSmall organic molecule
Emp. Form.C10H20N3O2
Mol. Mass.214.2842
SMILESCCOC(=O)N1CCC(CC1)\[NH+]=C(\C)N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a