Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetExcitatory amino acid transporter 1
LigandBDBM50293002
Substrate/Competitorn/a
Meas. Tech.ChEMBL_496042
IC50 3600±n/a nM
Citation Jensen, AAErichsen, MNNielsen, CWStensbøl, TBKehler, JBunch, L Discovery of the first selective inhibitor of excitatory amino acid transporter subtype 1. J Med Chem52:912-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Excitatory amino acid transporter 1
Name:Excitatory amino acid transporter 1
Synonyms:Excitatory Amino Acid EAAT1
Type:Enzyme Catalytic Domain
Mol. Mass.:59577.19
Organism:Homo sapiens (Human)
Description:Excitatory Amino Acid EAAT1 0 HUMAN::P43003
Residue:542
Sequence:
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIV
GTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPP
NLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSET
KM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293002
NameBDBM50293002
Synonyms:2-amino-4-(naphthalen-2-yl)-5-oxo-7-phenyl-5,6,7,8-tetrahydro-4H-chromene-3-carbonitrile | CHEMBL515558
TypeSmall organic molecule
Emp. Form.C26H20N2O2
Mol. Mass.392.4492
SMILESN=C1OC2=C(C(C1C#N)c1ccc3ccccc3c1)C(=O)CC(C2)c1ccccc1 |c:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a